7P3WG

F1fo-atp synthase from acinetobacter baumannii (state 3)
Total Genus 30

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
80
structure length
80
Chain Sequence
MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFV

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (1-40)TIV1 (41-44)AH2 (44-76)Updating...
connected with : NaN
molecule tags Membrane protein
publication title Structure of ATP synthase from ESKAPE pathogen Acinetobacter baumannii.
pubmed doi rcsb
molecule keywords ATP synthase subunit alpha
total genus 30
structure length 80
sequence length 80
chains with identical sequence H, J, K, L, O, P, Q, R, S
ec nomenclature
pdb deposition date 2021-07-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.