7P6JA

Crystal structure of glycosyl-enzyme intermediate of rbcel1 y201f
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
318
structure length
318
Chain Sequence
SVDLIGINVAGAEFTGGKLPGKHGTHYFFPPEGYFEYWSEQGIHTVRFPLKWERLQPSLNAELDDVYASLVDDMLDQAKENDIKVILDVHNYARYRKKVIGTEDVPVSAYQDLMERIAKRWQGHDALFAYDIMNEPYGSADKLWPAAAQAGIDGVRKYDKKRPLLIEGASWSSAARWPRYADELLKLKDPADNMVFSAHVFIDEDASGSYKKGPGKDFEPMIGVKRVEPFVNWLKEHGKKGHIGEFGIPNDDERWLDAMDKLLAYLNENCIPINYWAAGPSWGNYKLSIEPKDGEKRPQVALLKKYAAKDNCSDFGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highlighting the factors governing transglycosylation in the GH5_5 endo-1,4-beta-glucanase RBcel1.
pubmed doi rcsb
molecule tags Hydrolase
source organism Uncultured bacterium
molecule keywords Endoglucanase
total genus 127
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2021-07-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...