7PD0A

Functional and structural characterization of redox sensitive superfolder green fluorescent protein and variants
Total Genus 63

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
228
structure length
227
Chain Sequence
GEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATYGKLTLKFISTTGKLPVPWPTLVTTLVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNCHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTCSVLSKDPNEKRDHMVLLERVTAAGITHGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS5 (105-115)S1 (11-22)S2 (25-36)S11 (217-227)3H2 (37-39)S3 (41-48)S10 (199-208)TI9 (210-213)TIV2 (48-51)TVIII1 (53-56)S4 (92-100)3H3 (57-60)TI1 (60-63)TVIa1 (87-90)S9 (176-187)3H5 (79-81)TI2 (61-64)3H4 (69-71)AH1 (83-87)TII1 (100-103)TI4 (88-91)S6 (118-128)S8 (160-170)TI5 (131-134)TI6 (135-138)TIV5 (134-137)O1 (142-144)3H6 (156-158)S7 (148-155)TI8 (171-174)3H1 (5-7)TIV1 (21-24)TIV4 (114-117)TI3 (75-78)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Aequorea victoria
publication title Structure and Function of Redox-Sensitive Superfolder Green Fluorescent Protein Variant.
pubmed doi rcsb
molecule keywords Green fluorescent protein
total genus 63
structure length 227
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2021-08-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.