7PPPA

Crystal structure of zad-domain of znf_276 protein from rabbit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
73
Chain Sequence
HCRLCHGKFSSRSLRSISDGERVFVRDFQRLLGVAVHQDPALSQFVCRNCHAQFYQCHSLLESFLQRVNVSPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into highly similar spatial organization of zinc-finger associated domains with a very low sequence similarity.
pubmed doi rcsb
molecule tags Transcription
source organism Oryctolagus cuniculus
molecule keywords Zinc finger protein 276
total genus 16
structure length 73
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...