7PRPDDD

Crystal structure of the b subunit of heat labile enterotoxin lt-iic from escherichia coli in apo form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
GVSKTFKDKCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIELAPHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Heat-labile enterotoxin IIA, B chain
publication title Characterization of the ganglioside recognition profile of Escherichia coli heat-labile enterotoxin LT-IIc.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 104
sequence length 104
chains with identical sequence EEE, FFF, GGG, HHH
ec nomenclature
pdb deposition date 2021-09-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...