7PUBCq

Late assembly intermediate of the trypanosoma brucei mitoribosomal small subunit
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
252
structure length
252
Chain Sequence
YHAYVPKGASVQMGETFMPSNIATAVFRETEAAAARADKTKEETGFFSQPRLNYPVSSGIPALFSKDQFDMQYSLFHRDVVETLNRHTLGTPLEGHNLETVIRKTSFDATQAVAHTAASEHFNYCFFYKSLRPWGTAPPPRLREALQLQYGTNGSADAMDEVRRIVWVTAASHQERCGWVYLVWSGVHFDVVEFPHGSCPIASDLIPLLALNVHESAYILDYGTSGLKQYVENYFKACNWPLAERYYLMAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
pubmed doi rcsb
molecule keywords 9S rRNA
molecule tags Ribosome
total genus 71
structure length 252
sequence length 252
ec nomenclature ec 1.15.1.1: superoxide dismutase.
pdb deposition date 2021-09-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...