7PVTA

Crystal structure of the v-src sh3 domain q128r mutant in complex with the synthetic peptide vsl12
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
53
Chain Sequence
TTFVALYDYESWIETDLSFKKGERLQIVGNWWLAHSVTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the v-Src SH3 domain Q128R mutant in complex with the synthetic peptide VSL12
rcsb
molecule tags Protein binding
source organism Rous sarcoma virus (strain schmidt-ruppin e)
molecule keywords Tyrosine-protein kinase transforming protein Src
total genus 11
structure length 53
sequence length 57
chains with identical sequence C
ec nomenclature ec 2.7.10.2: non-specific protein-tyrosine kinase.
pdb deposition date 2021-10-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...