7PVUA

Crystal structure of p38alpha c162s in complex with cas2094511-69-8, p 1 21 1
Total Genus 106

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
349
structure length
337
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDSELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S3 (24-32)S4 (36-43)S5 (48-55)AH1 (62-77)EMPTYTI2 (44-47)3H1 (96-98)TIV5 (55-58)TIV6 (57-60)3H4 (306-308)3H5 (326-329)TI4 (159-162)TI3 (80-83)S6 (86-90)S7 (103-107)3H2 (153-155)AH3 (124-144)TIV7 (117-120)TI6 (292-295)S8 (156-158)TI8 (308-311)TIV8 (148-151)TI5 (186-189)TII1 (274-277)AH9 (279-288)AH4 (191-195)AH5 (202-218)TIV9 (221-224)AH6 (228-239)TIV10 (272-275)3H3 (270-272)TI7 (293-296)AH10 (299-304)TI9 (309-312)S1 (8-13)S2 (16-21)TI1 (33-36)TI10 (313-316)TIV11 (314-317)TIV1 (12-15)TIV4 (43-46)AH2 (113-116)AH7 (244-248)AH8 (253-261)Updating...
connected with : NaN
molecule tags Oncoprotein
source organism Mus musculus
publication title Characterization of p38 alpha autophosphorylation inhibitors that target the non-canonical activation pathway.
pubmed doi rcsb
molecule keywords Mitogen-activated protein kinase 14
total genus 106
structure length 337
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: mitogen-activated protein kinase.
pdb deposition date 2021-10-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...