7Q6PA

Crystal structure of bacterial prolyl peptidyl isomerase with 5,5'-difluoroleucines
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
169
structure length
164
Chain Sequence
MVTFHTNHGDIVIKTFDDKAPETVKNFDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGKNTRGTAMARTQAPHSATAQFFINVVDNDFNFSGESQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVSEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase B
publication title Crystal Structure of bacterial Prolyl Peptidyl Isomerase with 5,5'-difluoroleucines
rcsb
source organism Escherichia coli (strain k12)
total genus 40
structure length 164
sequence length 169
chains with identical sequence B, C, D
ec nomenclature ec 5.2.1.8: peptidylprolyl isomerase.
pdb deposition date 2021-11-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...