7QFYA

Fusarium oxysporum m36 protease without the propeptide
Total Genus 132
50100150200250300350020406080100120
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
388
structure length
388
Chain Sequence
ATYKVYPWGVNDPSKGSRSTVENPWNLAASEFTWLSDGSNNYTTTRGNNGIAQVNPSGGSTYLNNYRPDSPSLKFEYDYSTSTTTPTTYRDASIAQLFYTANKYHDLLYLLGFTEQAGNFQTNNNGQGGVGNDMVILNAQDGSGTNNANFATPADGQPGRMRMCLWTYSTPQRDCSFDAGVVIHEYTHGLSNRLTGGPANSGCLPGGESGGMGEGWGDFMATAIHIQSKDTRASNKVMGDWVYNNAAGIRAYPYSTSLTTNPYTYKSVNSLSGVHAIGTYWATVLYEVMWNLIDKHGKNDADEPKFNNGVPTDGKYLAMKLVVDGMSLQPCNPNMVQARDAIIDADTALTKGANKCEIWKGFAKRGLGTGAKYSASSRTESFALPSGC
5010015020025030035035030025020015010050
020406080100120Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (21-24)S1 (2-5)TI10 (70-73)TII1 (7-10)AH1 (90-111)TI1 (12-15)TIV8 (237-240)TI3 (26-29)TI4 (27-30)TI5 (30-33)TI7 (47-50)TI6 (33-36)TIV3 (37-40)TVIII1 (121-124)S3 (46-47)S4 (50-55)S6 (135-141)TI9 (62-65)TI12 (141-144)TI8 (55-58)S8 (160-163)S5 (74-75)3H1 (86-89)S10 (173-174)3H3 (175-177)AH2 (179-194)AH5 (314-328)O1 (112-114)3H2 (115-117)S9 (165-166)S7 (148-151)TII2 (154-157)TI13 (197-200)TI17 (241-244)TIV5 (169-172)TIV9 (239-242)AH3 (207-225)TII3 (194-197)TIV6 (200-203)TIV12 (330-333)3H4 (265-270)AH6 (335-350)TIV13 (375-378)TI15 (231-234)TI16 (240-243)TIV10 (257-260)TI19 (258-261)AH7 (354-365)S11 (306-307)S12 (310-311)TI'3 (350-353)TI20 (368-371)TI21 (374-377)S2 (19-22)TI11 (80-83)TI'1 (124-127)TI14 (227-230)TI18 (245-248)AH4 (274-296)Updating...
connected with : NaN
molecule tags Recombination
source organism Fusarium oxysporum
publication title Fusarium oxysporum M36 protease without the propeptide
rcsb
molecule keywords Extracellular metalloproteinase
total genus 132
structure length 388
sequence length 388
ec nomenclature ec 3.4.24.-:
pdb deposition date 2021-12-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.