7QP0A

Crystal structure of metacaspase from candida glabrata with magnesium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
320
structure length
265
Chain Sequence
GMVRPPSSIQQGNGQQFQYSQMTGRRKALLIGINYIGSKNALRGCINDAHNIFNYLTTYCGYRPEDIVMLTDDQREMVKIPLKENIIRAMQWLVKDAQPNDALFFHYSGHGGQTKDLDGDEEDGMDDVIYPVDFESVGPLIDDTMHDIMVKSLPQGARLTALFDSCHSGTVLDLPYTYSTKGVIKEPKFSPADVIMLSGSKADTFADGQNIGAMSHAFISVMTRQPQQSYLSLLQNLRNELAGKYSQKPQLSASHPIDVNLQFIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Metacaspase-1
publication title Structural and molecular determinants of Candida glabrata metacaspase maturation and activation by calcium.
pubmed doi rcsb
source organism [candida] glabrata
total genus 81
structure length 265
sequence length 320
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2021-12-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...