7QQAA

Mgadp-bound fe protein of the iron-only nitrogenase from azotobacter vinelandii
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
273
structure length
273
Chain Sequence
TRKVAIYGKGGIGKSTTTQNTAAALAYFHDKKVFIHGCDPKADSTRLILGGKPQETLMDMLRDKGAEKITNDDVIKKGFLDIQCVESGGPEPGVGCAGRGVITAIDLMEENGAYTDDLDFVFFDVLGDVVCGGFAMPIRDGKAQEVYIVASGEMMAIYAANNICKGLVKYAKQSGVRLGGIICNSRKVDGEREFLEEFTAAIGTKMIHFVPRDNIVQKAEFNKKTVTEFAPEENQAKEYGELARKIIENDEFVIPKPLTMDQLEDMVVKYGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MgADP-bound Fe protein of the iron-only nitrogenase from Azotobacter vinelandii
rcsb
molecule keywords Nitrogenase iron protein
molecule tags Electron transport
total genus 96
structure length 273
sequence length 273
chains with identical sequence B, C, D
ec nomenclature ec 1.18.6.1: nitrogenase.
pdb deposition date 2022-01-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...