7QV1c

Bacillus subtilis collided disome (leading 70s)
Total Genus 45
20406080100120140160180200010203040
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
206
structure length
206
Chain Sequence
GQKVNPVGLRIGVIRDWESKWYAGKDYADFLHEDLKIREYISKRLSDASVSKVEIERAANRVNITIHTAKPGMVIGKGGSEVEALRKALNSLTGKRVHINILEIKRADLDAQLVADNIARQLENRVSFRRAQKQQIQRTMRAGAQGVKTMVSGRLGGADIARSEYYSEGTVPLHTLRADIDYATSEADTTYGKLGVKVWIYRGEVL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (6-9)TI2 (7-10)TI4 (9-12)TIV1 (12-15)S1 (20-21)AH1 (28-46)TVIII1 (18-21)S2 (53-59)AH2 (80-94)TI5 (46-49)TI7 (107-110)TI'1 (59-62)TIV5 (69-72)TIV6 (74-77)TII'1 (76-79)S4 (98-103)TIV7 (105-108)AH4 (129-143)AH3 (112-125)TI8 (108-111)S5 (147-154)S6 (163-170)TIV8 (145-148)S8 (193-202)TIV9 (155-158)TIV11 (176-179)S7 (181-190)TI10 (190-193)TII1 (11-14)TIV3 (24-27)S3 (62-68)3H1 (72-74)TI9 (173-176)Updating...
connected with : NaN
publication title Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L32
molecule tags Ribosome
total genus 45
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2022-01-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.