7QV2U

Bacillus subtilis collided disome (collided 70s)
Total Genus 9

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
101
structure length
101
Chain Sequence
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S9 (89-94)TIV1 (1-4)S1 (7-11)S2 (19-27)TII1 (4-7)S7 (68-69)TIV2 (13-16)TII3 (35-38)3H1 (28-30)EMPTYS3 (32-35)S6 (62-64)TIV4 (37-40)O2 (43-45)S4 (40-44)3H2 (65-67)TI1 (73-76)TIV7 (72-75)TIV9 (94-97)S8 (81-86)S5 (56-60)TIV5 (48-51)Updating...
connected with : NaN
publication title Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L32
molecule tags Ribosome
total genus 9
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2022-01-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.