7QVYA

Cryo-em structure of coxsackievirus a6 empty particle
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
217
Chain Sequence
GVNEASVEHFYSRAGLVGVVEVKDSGTSQDGYTVWPIDVMGFVQQRRKLELSTYMRFDAEFTFVSNLNDSTTPGMLLQYMYVPPGAPKPDGRKSYQWQTATNPSIFAKLSDPPPQVSVPFMSPASAYQWFYDGYPTTNLQYGQCPNNMMGHFAIRTVSESTTGKNVHVRVYMRIKHVRAWVPRPFRSQAYMVKNYPTYSQTISNTAADRASITTTDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-electron microscopy and image classification reveal the existence and structure of the coxsackievirus A6 virion.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein VP1
total genus 39
structure length 217
sequence length 224
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2022-01-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...