7R22A

Crystal structure of protein mab3862 from mycobacterium abscessus
Total Genus 22

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
DADEDKADAMFHALSDRTRRDILRRVLAGEHSVSTLAANYDMSFAAVQKHVAVLEKAGLLTKRRNGREQLASGDVEAVRSVGAMLSELEQLWRGRIARIDE

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV3 (45-48)TIV1 (41-44)3H1 (49-52)AH1 (57-67)TI2 (52-55)TI3 (53-56)AH2 (73-79)AH3 (86-97)TIV2 (44-47)TIV4 (83-86)Updating...
connected with : NaN
molecule tags Antitoxin
source organism Mycobacteroides abscessus
publication title Structure of putative ArsR family regulator antitoxin from Mycobacterium abscessus (MAB_3862)
rcsb
molecule keywords ArsR family transcriptional regulator
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2022-02-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.