7R7MA

Crystal structure of triosephosphate isomerase from candidate division katanobacteria (wwe3) bacterium
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
216
structure length
216
Chain Sequence
MKYIVANWKMNMSLQDVIGWTAGFDTSVLNADIEAIVAPSSLHIFPVAEILKKTGVSVAAQDVSVEEKGAHTGETGAFQIKELCKYAVIGHSERKETPEIVAKKIDICLTNGIIPIVCFVEPKKISLYKRPGIMYAWEDPANISKNGRYKEKSEEEIKEGVNKIREILDDKEPLLYGGSVNGQNISGLVNIEKLDGVLVGHASLDPRHFSGIIASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of WweTPI - Candidate division WWE3
rcsb
molecule keywords Triosephosphate isomerase
molecule tags Isomerase
source organism Candidate division wwe3 bacterium raac2_wwe3_1
total genus 66
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 5.3.1.1: triose-phosphate isomerase.
pdb deposition date 2021-06-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...