7R86C

Structure of mouse bai1 (adgrb1) in complex with mouse nogo receptor (rtn4r)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
52
structure length
44
Chain Sequence
AWDEWSPWSLCSSTCGRGFRDRTRTCRCEGPEKQTKFCNIALCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Reticulon-4 receptor
publication title RTN4/NoGo-receptor binding to BAI adhesion-GPCRs regulates neuronal development.
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 44
sequence length 52
chains with identical sequence D
ec nomenclature
pdb deposition date 2021-06-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...