7R9DN

Crystal structure of nb_0 in complex with fab_8d3
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
113
Chain Sequence
QLVEYGGGSVQAGGYLRLSCVASGSISLSSGMGWYRQAPGKERELVASISGGSSTNYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAAAYWGQGTQVTVSSLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure determination of small proteins by nanobody-binding scaffolds (Legobodies).
pubmed doi rcsb
molecule tags Protein binding
source organism Mus musculus
molecule keywords Fab 8D3 light chain
total genus 25
structure length 113
sequence length 121
ec nomenclature
pdb deposition date 2021-06-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...