7RAIL

Cryo-em structure of m4008_n1 fab in complex with bg505 ds-sosip.664 env trimer
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSTVAAFVGGNVTLSCRTSQGVGNRLAWYQQKPGKPPRLLISRASNRHGGVPARFSGGGSGTIFTLTIKGLQSDDFATFFCQQYYDSRETFGQGSRVMMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A site of vulnerability at V3 crown defined by HIV-1 bNAb M4008_N1.
pubmed doi rcsb
molecule keywords Envelope glycoprotein gp160
molecule tags Immune system
source organism Human immunodeficiency virus 1
total genus 14
structure length 108
sequence length 108
chains with identical sequence M, N
ec nomenclature
pdb deposition date 2021-07-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...