7REAA

Apo hemophilin from a. baumannii
Total Genus 64

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
244
structure length
244
Chain Sequence
SGIDGISSNESNIKIGAAANASHPGGVAAVSVQAAGAPYNAFTGFSSLKGLAQAFAAQGTSNTNVTVGSKTFNISHIPVSAMPPSHSALGNFNFGQVGTQEVYFGEWWKAGDTPASASHTVYYAGDNTNTTVPTAGTATYTVAGINGSGSNLLSGTFTANYGAGTLEGTLTGTGTAVSSLSLDGVAFNPGTAAFAGLATANGTAGIDNSGVVQGQFFGANASALAGIAQFDNVSYNTAFGGAKN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS14 (213-222)O1 (120-122)S2 (33-37)TII'2 (117-120)TI1 (29-32)TVIII1 (27-30)S1 (23-27)TII1 (43-46)3H2 (99-101)TVIII2 (41-44)TIV2 (38-41)S3 (48-52)S6 (90-97)TIV3 (57-60)TI2 (52-55)TVIa1 (56-59)3H1 (76-78)TI3 (58-61)AH1 (65-75)S16 (243-249)S5 (81-87)TIV4 (86-89)3H3 (104-109)S8 (122-128)TI6 (147-150)S7 (111-117)TII2 (129-132)S10 (157-165)TI4 (133-136)TI5 (136-139)S9 (140-146)3H4 (239-241)S11 (172-180)TI7 (168-171)TIV5 (165-168)S12 (185-191)TI8 (180-183)TIV6 (192-195)TVIII3 (195-198)S13 (197-206)TII3 (208-211)S15 (226-237)TI10 (222-225)S4 (62-64)Updating...
connected with : NaN
molecule tags Metal transport
source organism Acinetobacter baumannii niph 201
publication title A Slam-dependent hemophore contributes to heme acquisition in the bacterial pathogen Acinetobacter baumannii.
pubmed doi rcsb
molecule keywords Hemophilin
total genus 64
structure length 244
sequence length 244
ec nomenclature
pdb deposition date 2021-07-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.