7RGCA

Crystal structure of triosephosphate isomerase from candidatus absconditabacteria (sr1) bacterium
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
244
structure length
238
Chain Sequence
SHMKYLIGANFKMYKSHKDLQEYFDQFVNNYACFVNIDLMIAPMTVCLGTASEMTKDSCVHLGAQNMHYEDQGAYTGETSPLILKELGAEYVIIGHSERRQYFGETNQMINKKLKSALQHGIRPILCIGENLEQKELGISKETLKIQLREALQGIDTLDQIDVAYEPVRAITPEEVQDIHEYIRSVLGNEKSRIIYGGSVNDTNADILIAQPAVNGFLIGSASLDPQKFLKILDVVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Sr1TPI - Candidatus Absconditabacteria bacterium triosephoshate isomerase
rcsb
molecule tags Isomerase
source organism Candidate division sr1 bacterium raac1_sr1_1
molecule keywords Triosephosphate isomerase
total genus 80
structure length 238
sequence length 244
chains with identical sequence B
ec nomenclature ec 5.3.1.1: triose-phosphate isomerase.
pdb deposition date 2021-07-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...