7RGNA

Crystal structure of putative fructose-1,6-bisphosphate aldolase from candida auris
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
357
structure length
340
Chain Sequence
MAEVLKKSGVIYGDDVRKLFDYAQEKGFAIPAINVTSSSTVVAALESARDNKSPIILQTSQGGAAYFAGKGVSNSDQTASIQGSIAAAHYIRAISPVYGIPVILHTDHCAKKLLPWFDGMLKADEEFFAKTGQPLFSSHMLDLSEETDDENIATCVKYFERMSKMNQWLEMEIGITGGESLYTQPETVFAVYKALAPISPNFSIAAAFGNVHGNVQLRPSILGEHQKYAKEQIGTDNKKPLYLVFHGGSGSSQEEFDTAIASGVVKVNLDTDCQYAYLTGIRDYILNKKEYLMTPVGNPDGEDKPNKKYFDPRVWVREGEKSMSARIAEALEIFHTKNQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative fructose-1,6-bisphosphate aldolase from Candida auris
rcsb
molecule keywords Fructose-bisphosphate aldolase
molecule tags Lyase
source organism Candida auris
total genus 127
structure length 340
sequence length 357
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2021-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...