7RJZA

Bthtx-ii variant a, from bothrops jararacussu venom, complexed with benzoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
121
structure length
121
Chain Sequence
DLWQFGQMILKETGKLPFPYYTTYGCYCGWGGQGQPKDATDRCCFVHDCCYGKLTACKPKTDRYSYSRENGVIICGEGTPCQKQICECDKAAAVCFRENLRTYLARYMAYPDVLCAVPEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BthTX-II from Bothrops jararacussu venom has variants with different oligomeric assemblies: An example of snake venom phospholipases A 2 versatility.
pubmed doi rcsb
molecule tags Toxin
molecule keywords BthTX-IIa
total genus 44
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-07-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...