7RLYA

Antibody 2f2 in complex with p. vivax csp peptide draagqpagdradgqpa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
QLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRIDPYDGATSYNQNFKDKASLTVDKSSTTGFMELHSLTSEDSAVYYCAREGHWDGDWYFDVWGAGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords peptide from Circumsporozoite protein variant VK210
publication title Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 221
sequence length 221
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2021-07-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...