7RQ815

Crystal structure of the wild-type thermus thermophilus 70s ribosome in complex with iboxamycin, mrna, deacylated a- and e-site trnas, and aminoacylated p-site trna at 2.50a resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
59
structure length
59
Chain Sequence
AKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A synthetic antibiotic scaffold effective against multidrug-resistant bacterial pathogens
rcsb
molecule keywords 23S Ribosomal RNA
molecule tags Ribosome/rna
source organism Escherichia coli
total genus 6
structure length 59
sequence length 59
chains with identical sequence 25
ec nomenclature
pdb deposition date 2021-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
15 PF01783 Ribosomal_L32p Ribosomal L32p protein family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...