7RQ81X

Crystal structure of the wild-type thermus thermophilus 70s ribosome in complex with iboxamycin, mrna, deacylated a- and e-site trnas, and aminoacylated p-site trna at 2.50a resolution
Total Genus 19

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (4-6)TIV1 (6-9)S1 (8-11)TI1 (31-34)AH1 (15-19)3H2 (21-23)S6 (76-83)EMPTYS2 (25-30)TIV2 (89-92)TI2 (90-93)S3 (51-59)TII1 (84-87)AH2 (36-47)S4 (63-66)S5 (69-72)Updating...
connected with : NaN
molecule tags Ribosome/rna
source organism Escherichia coli
publication title A synthetic antibiotic scaffold effective against multidrug-resistant bacterial pathogens
rcsb
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
chains with identical sequence 2X
ec nomenclature
pdb deposition date 2021-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1X PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.