7RRJA

Crystal structure of fast switching m159q mutant of fluorescent protein dronpa (dronpa2)
Total Genus 59

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
217
structure length
216
Chain Sequence
AVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNQALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSGLP

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (2-5)S5 (100-110)S1 (8-18)S3 (37-46)TIV2 (17-20)3H1 (33-35)S2 (21-32)S12 (206-216)TVIII2 (204-207)TIV3 (47-50)TIV7 (129-132)3H2 (54-60)S4 (87-95)EMPTYTIV6 (109-112)TI2 (72-75)S10 (168-179)TIV5 (77-80)TI4 (79-82)TI3 (78-81)TI5 (80-83)TVIb1 (82-85)S6 (113-123)S9 (152-163)TI9 (130-133)TI10 (131-134)S7 (136-139)TI11 (163-166)S11 (189-200)S8 (142-149)TIV8 (148-151)TIV9 (164-167)TVIII1 (5-8)TI8 (126-129)TI1 (65-68)TI6 (83-86)TI7 (95-98)TI12 (201-204)Updating...
connected with : NaN
molecule tags Fluorescent protein
source organism Echinophyllia sp. sc22
publication title Crystal structure of fast switching M159Q mutant of fluorescent protein Dronpa (Dronpa2)
rcsb
molecule keywords Fluorescent protein Dronpa
total genus 59
structure length 216
sequence length 217
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2021-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.