7RRO1

Structure of the 48-nm repeat doublet microtubule from bovine tracheal cilia
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
156
structure length
152
Chain Sequence
LLKPEDIVLKEPGSSEKTLRTLLRPSDKVSNHYKTTSSEISAVVGACYPTYGVPTIRSDIPAPLIRRVSDRTSYGEEGNAYSLLHPTIFAQKGVFERDFFKTRSKQEISEILCNIGVKLSEDEFENVWNLASKKHHRGEVCVENIRSVLDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title De novo identification of mammalian ciliary motility proteins using cryo-EM
doi rcsb
molecule keywords Protein C9orf135 homolog
molecule tags Structural protein
total genus 16
structure length 152
sequence length 156
chains with identical sequence 2
ec nomenclature
pdb deposition date 2021-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...