7RW8S

Ap2 bound to heparin in the closed conformation
Total Genus 41
204060801001201400510152025303540
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSL

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S1 (2-9)TIV2 (118-121)TI1 (9-12)AH3 (100-105)S2 (14-19)AH4 (107-117)AH1 (25-41)EMPTYTII'1 (52-55)TI2 (43-46)S6 (118-119)S7 (122-123)TI3 (72-75)S3 (49-52)S4 (55-62)AH2 (77-95)AH5 (128-140)TIV1 (95-98)S5 (65-71)Updating...
connected with : NaN
molecule tags Endocytosis
source organism Mus musculus
publication title Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
pubmed doi rcsb
molecule keywords AP-2 complex subunit alpha-2
total genus 41
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2021-08-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.