7S1HE

Wild-type escherichia coli ribosome with antibiotic linezolid
Total Genus 50
2040608010012014016018020001020304050
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
206
structure length
206
Chain Sequence
GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEI
2040608010012014016018020020015010050
01020304050Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (7-11)TIV1 (12-15)S6 (181-191)AH2 (26-47)TVIII1 (18-21)EMPTYTI2 (47-50)3H1 (109-111)S1 (52-58)TIV3 (59-62)TIV4 (60-63)S3 (99-105)S2 (64-70)TIV5 (70-73)AH3 (73-77)TII1 (78-81)TIV6 (77-80)AH4 (82-95)AH5 (113-126)S5 (165-171)S4 (148-154)TVIII2 (160-163)TI4 (174-177)TI5 (177-180)TI1 (11-14)TIV8 (106-109)S7 (194-205)TI6 (191-194)AH6 (130-144)3H2 (157-159)TIV9 (154-157)Updating...
connected with : NaN
molecule tags Ribosome/antibiotic
publication title Structural basis for context-specific inhibition of translation by oxazolidinone antibiotics.
pubmed doi rcsb
molecule keywords 30S ribosomal protein S19
total genus 50
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2021-09-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.