7S5JA

Solution nmr structure of substrate bound peptidase domain from pcat1
Total Genus 28

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
151
structure length
151
Chain Sequence
SNAMLRRLFKKKYVCVRQYDLTDAGAACLSSIAQYYGLKMSLAKIREMTGTDTQGTNAYGLIHAAKQLGFSAKGVKASKEDLLKDFRLPAIANVIVDNRLAHFVVIYSIKNRIITVADPGKGIVRYSMDDFCSIWTGGLVLLEPGEAFQKG
2040608010012014014012010080604020
0510152025Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (6-9)TVIII1 (2-5)3H1 (21-23)AH2 (42-49)O1 (38-40)TI1 (52-55)TIV2 (53-56)EMPTYTIV5 (145-148)S1 (72-75)3H2 (79-83)TIV3 (83-86)AH4 (128-134)S2 (90-96)TI'1 (96-99)S3 (100-110)TIV4 (109-112)S6 (135-142)TI3 (147-150)AH1 (24-36)S4 (113-117)S5 (123-127)TI2 (118-121)AH3 (58-68)Updating...
connected with : NaN
molecule tags Peptide binding protein
source organism Hungateiclostridium thermocellum (strain atcc 27405 / dsm 1237 / jcm 9322 / nbrc 103400 / ncimb 10682 / nrrl b-4536 / vpi 7372)
publication title Structural and dynamic studies of the peptidase domain from Clostridium thermocellum PCAT1.
pubmed doi rcsb
molecule keywords Peptidase C39
total genus 28
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2021-09-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.