7S7MB

Complex of tissue inhibitor of metalloproteinases-1 (timp-1) mutant (l34g/m66d/t98g/p131s/q153n) with matrix metalloproteinase-3 catalytic domain (mmp-3cd)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
179
structure length
173
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTGYQRYEIKMTKMYKGFQAIRFVYTPADESVCGYFHRSHNRSEEFLIAGKLQDGLLHITGCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFSCLSIPCKLQSGTHCLWTDQLLNGSEKGFQSRHLACLPREPGLCTWQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering of tissue inhibitor of metalloproteinases TIMP-1 for fine discrimination between closely related stromelysins MMP-3 and MMP-10.
pubmed doi rcsb
molecule keywords Stromelysin-1
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
total genus 39
structure length 173
sequence length 179
ec nomenclature
pdb deposition date 2021-09-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...