7S8VA

Leg region of a complex of igf-i with the ectodomain of a hybrid insulin receptor / type 1 insulin-like growth factor receptor
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
320
structure length
264
Chain Sequence
ASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title How insulin-like growth factor I binds to a hybrid insulin receptor type 1 insulin-like growth factor receptor.
pubmed doi rcsb
molecule tags Signaling protein
source organism Homo sapiens
molecule keywords Insulin-like growth factor 1 receptor
total genus 41
structure length 264
sequence length 320
ec nomenclature ec 2.7.10.1: receptor protein-tyrosine kinase.
pdb deposition date 2021-09-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...