7SDEB

Cryo-em structure of nse5/6 heterodimer
Total Genus 49

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
269
structure length
238
Chain Sequence
DKYKDWHFISKNCHYEQLMDLEMKDTAYSFLEFVHLKCPSITNLLVLFGVNQEKLKINYEKKENSRYDNLCTIFPVNKMLKFLMYFYSDDDNDDVREFFLKAFICLILDRKVFNAMESDHRLCFKVLELFNEAHFINSYFEIVDKNDFFLHYRLLQIFPHLQSALLRRRFSTIQQNIIKEFNEFFDCKNYKNLLYFILTMYGSKFIPFGPKEYFKDCILDISVEISILKGILNLFSKI

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
TIV1 (195-198)TIV2 (201-204)EMPTYTIV3 (216-219)AH2 (219-224)TVIII1 (237-240)AH1 (209-216)Updating...
connected with : NaN
molecule tags Structural protein
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
publication title The cryo-EM structure of Nse5/6 complex with the C terminal part of Nse5
rcsb
molecule keywords Non-structural maintenance of chromosome element 5
total genus 49
structure length 238
sequence length 269
ec nomenclature
pdb deposition date 2021-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08691 Nse5 DNA repair proteins Nse5 and Nse6
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.