7SFWM

Cryoem structure of venezuelan equine encephalitis virus (veev) tc-83 strain vlp in complex with fab hveev-63 (focus refine of the asymmetric unit)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
122
structure length
122
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKSSGYTFTNYIIHWVRQAPGQRLEWMGWINAGNGNTKYSQKFQGRISVTRDTSASAAYMELSSLKSEDTALYYCATLQMDYGGNGDLDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralizing antibodies protect mice against Venezuelan equine encephalitis virus aerosol challenge.
pubmed doi rcsb
molecule keywords Spike glycoprotein E1
molecule tags Virus/immune system
source organism Venezuelan equine encephalitis virus (strain tc-83)
total genus 18
structure length 122
sequence length 122
chains with identical sequence O, Q, S
ec nomenclature
pdb deposition date 2021-10-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...