7SQZA

Csdav wild-type
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
161
structure length
161
Chain Sequence
APSVDYPFQWVVASYDGSEAKNLSDDLSGSATLTKVMANYRHAELTSVELEVCPLAAAFSKPISVSAVWTIASISPASASETSYYGGRLFTVGGPVLMSSTTHLPADLTRLNPVLKGPVKYTDCPRFSYSVYSNGGTKGTNLCTIILRGVVRLSGPSGNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Citrus sudden death-associated virus as a new expression vector for rapid in planta production of heterologous proteins, chimeric virions, and virus-like particles.
pubmed doi rcsb
molecule tags Virus
source organism Citrus sudden death-associated virus
molecule keywords Citrus Sudden Death-associated Virus Capsid Protein
total genus 30
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2021-11-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...