7SUBA

3-oxoacyl-acp reductase fabg
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
250
structure length
222
Chain Sequence
GKLDGKVAVVTGGGRGVGRAICVAYAEEGADVVVNYAGNHAAANEVVAMIEKMGRRAVAVQGRVEIKAEAEKTIQTAVDNFGRIDVLVNNAGATKPAMLHKMWDAVVNIHLKGPFLCVQAAAKYFMEQNYGKIINVTSVAGGILSFTMSAARELARFNVTSNVISLGIVTTDMLKEIYMRRILLNRYAEPSEVAPAFVFFGCDDSKYITGQLLKVDGGYGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative 3-hydroxypimelyl-CoA dehydrogenase, Hcd1, from Syntrophus aciditrophicus strain SB at 1.78 A resolution
rcsb
molecule keywords 3-oxoacyl-reductase
molecule tags Oxidoreductase
source organism Syntrophus aciditrophicus sb
total genus 83
structure length 222
sequence length 250
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2021-11-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...