7SWLA

Cryoem structure of the n-terminal-deleted rix7 aaa-atpase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
601
structure length
553
Chain Sequence
SILDIAGVDDTLQRLLKEVWFPLRGGEACEKMGYRYDNGVLLHGPSGCGKTTLAHAIAGSIGVAFIPVSAPSVIGGTSGESEKNIRDVFDEAIRLAPCLIFLDQIDAIAGGMESRIVAEIMNGMDRIRQNTPLGKNVVVLAATNRPEFLDPAIRRRFSVEIDMGMPSERAREQILRSLTRDLSLADDINFKELAKMTPGYVGSDLQYVVKAAVSESFQANIDSLLAQARAKHPADHLANVSQPQRDWLLLEAHRDEWPSTKITMEQFRKAVSLVQPASKREGFSTIPDTTWSHVGALEDVRKKLEMSIIGPIKNPELFTRVGIKPAAGILLWGPPGCGKTLVAKAVANESKANFISIKGPELLNKYVGESERAVRQLFSRAKSSAPCILFFDQMDALVPRRDDSLSDASARVVNTLLTELDGVGDRSGIYVIGATNRPDMIDEAIRRPGRLGTSIYVGLPSAEDRVKILKTLYRNTVTTDADLEKVALDLRCTGFSGADLGNLMQAAAQACLERVYTQRQQKRKEPVITMEDWEKALNEVKPSVKDPEKYMHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords Rix7
publication title Communication network within the essential AAA-ATPase Rix7 drives ribosome assembly.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 148
structure length 553
sequence length 601
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2021-11-20
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...