7SZSA

Crystal structure of probable gtp-binding protein engb bound to gdp from klebsiella pneumoniae subsp. pneumoniae
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
209
structure length
204
Chain Sequence
HHHMLTNWNYQLTHFVTSAPDIRHLPADTGIEVAFAGRSNAGKSSALNTLTNQKNLARTSTQLINLFEVAEGKRLVDLPGYGYAQVPEEMKIKWQRALGEYLEKRLCLKGLVVLMDIRHPLKDLDQQMIEWAVESDIQVLVLLTKADKLASGARKAQVNMVREAVLAFNGDVQVEPFSSLKKSGVDKLRQKLDSWFNEIPPQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Probable GTP-binding protein EngB bound to GDP from Klebsiella pneumoniae subsp. pneumoniae
rcsb
molecule tags Cell cycle
source organism Klebsiella pneumoniae subsp. pneumoniae (strain hs11286)
molecule keywords Probable GTP-binding protein EngB
total genus 63
structure length 204
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2021-11-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...