7T1UA

Crystal structure of a superbinder src sh2 domain (ssrcf) in complex with a high affinity phosphopeptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
105
Chain Sequence
APWQAEEWYFGKITRRESERLLLNAENPRGTFLVREGQSQPDYVLSVSDFDNAKGLNVKHYIIRKLDSGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Engineered SH2 Domains for Targeted Phosphoproteomics.
pubmed doi rcsb
molecule tags Signaling protein
source organism Homo sapiens
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 23
structure length 105
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.10.2: non-specific protein-tyrosine kinase.
pdb deposition date 2021-12-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...