7T7YA

The crystal structure of family 8 carbohydrate-binding module from dictyostelium discoideum complexed with iodine atoms
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
154
structure length
154
Chain Sequence
GAMGESLSIYKSGLKNDFQDWSWGEHSLTDTTNVESGETNSISFTPKAYGAVFLGCFECIDTDTYNNIEFDINGGSSGAQLLRITVVKNSKSVGSKLITDLNGGTPIEANSWTKIKASFIDDFKVSGKVDGIWIQDIKGDTQSTVYISNIIATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Endoglucanase
publication title Unique properties of a Dictyostelium discoideum carbohydrate-binding module expand our understanding of CBM-ligand interactions.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 45
structure length 154
sequence length 154
ec nomenclature ec 3.2.1.4: cellulase.
pdb deposition date 2021-12-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...