7T92C

Structure of the peroxisomal retro-translocon formed by a heterotrimeric ubiquitin ligase complex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
433
structure length
317
Chain Sequence
PYAAAPDIIRAHQKDAYFQGVLANRLSDLHRRLRGARSAHAWAAETRTFAAALYLCLTTLLGNRTLGEEYCDLVQVEEGPLLPSLPRRAGYILTAIVLPHLASRALPSVRSAIRKRLQSRLVLRYLLTHLTPLTSGAHFRAATLAVFYFTGAYYELSKWVWGLRYVFTGYEVLGVLLVVQMAVRAWLHVREQLRTAFGPGTNVDVSLDEHAFTSNNELLGGGSSQRSLGEIGAMAHTPVLKAGRARYDLGTSDKVMGWIKGAQQRKCTLCLEELKDPAATQCGHVFCWACIGDWVREKPECPLCRREAMVQHILPLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translocase
molecule keywords Peroxin-12
publication title A peroxisomal ubiquitin ligase complex forms a retrotranslocation channel.
pubmed doi rcsb
source organism Thermothelomyces thermophilus atcc 42464
total genus 83
structure length 317
sequence length 433
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2021-12-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...