7T9HA

Hiv integrase in complex with compound-15
Total Genus 49

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
QVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
S3 (83-89)TI1 (57-60)S1 (60-68)S2 (71-78)TI2 (78-81)TI3 (79-82)TVIII1 (89-92)S4 (112-115)TI4 (118-121)TI6 (120-123)AH2 (124-133)TI5 (119-122)TII1 (141-144)TI7 (144-147)AH3 (148-165)EMPTYAH1 (94-106)S5 (136-139)TIV1 (67-70)O1 (108-110)Updating...
connected with : NaN
molecule tags Dna binding protein, viral protein
source organism human immunodeficiency virus 1
publication title Design, Synthesis, and Preclinical Profiling of GSK3739936 (BMS-986180), an Allosteric Inhibitor of HIV-1 Integrase with Broad-Spectrum Activity toward 124/125 Polymorphs.
pubmed doi rcsb
molecule keywords Integrase
total genus 49
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2021-12-19
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.