7TAND

Structure of vrk1 c-terminal tail bound to nucleosome core particle
Total Genus 31

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
93
structure length
93
Chain Sequence
SRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (49-52)AH3 (91-101)AH1 (37-48)AH2 (56-84)Updating...
connected with : NaN
molecule tags Structural protein/dna/transferase
source organism Homo sapiens
publication title Multivalent DNA and nucleosome acidic patch interactions specify VRK1 mitotic localization and activity.
pubmed doi rcsb
molecule keywords Histone H3.2
total genus 31
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2021-12-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.