7TEBH

Cryo-em structure of glun1b-2b nmdar complexed to fab2 non-active1-like
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
119
structure length
117
Chain Sequence
VKLQESGGGLVQPGGSLKLSCAASTFSSYTMSWVRQTPEKRLEWVAYISNGGGGTYYPDTVKGRFTISRDNAKNTLYLQMNSLKEDTAMYYCARPSRGGSSYWYFDVWGAGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/immune system
molecule keywords Glutamate receptor ionotropic, NMDA 1
publication title Development and characterization of functional antibodies targeting NMDA receptors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 13
structure length 117
sequence length 119
chains with identical sequence M
ec nomenclature
pdb deposition date 2022-01-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...