7TEJL

Cryo-em structure of the 20s alpha 3 deletion proteasome core particle
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
212
structure length
201
Chain Sequence
TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Yeast PI31 inhibits the proteasome by a direct multisite mechanism.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Proteasome subunit beta type-6
total genus 63
structure length 201
sequence length 212
chains with identical sequence Z
ec nomenclature ec 3.4.25.1: proteasome endopeptidase complex.
pdb deposition date 2022-01-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...