7TGH2

Cryo-em structure of respiratory super-complex ci+iii2 from tetrahymena thermophila
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
359
structure length
359
Chain Sequence
LLRLLVSEYIFFLPVFTNLFIYWHIFFKNNINLVNKKNNWDKSISVKNIIIKQNPSFIIRLNLLLNSLMVLYLITFNGYSSTFWWSHFKLNNYSLYMYLLVIIFNNYFLYITEKHIKILNNYSIDYFFSIINITLFIPMIFLSNTLFTFFFLIELVSCAIFYKFIVSKISFKNSNYKDNYFSIFSKNYLNVLFYQYWSSFFSSVMIGFCIIYLFSLTGSTEWSIINFIVASNNQINYYTNNITLLFICLTLIIGFIIKLGIAPIQLYKIEIYKGLPFLSIFFYTTFYFLIFFLFFSLLFIYYLSALNNFFWIILLIISIIGIFYIISIIFDINLFKAFLAYSTIINSISFILLIIAIIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords NADH-ubiquinone oxidoreductase chain 1
publication title Structures of Tetrahymena 's respiratory chain reveal the diversity of eukaryotic core metabolism.
pubmed doi rcsb
total genus 126
structure length 359
sequence length 359
ec nomenclature
pdb deposition date 2022-01-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...