7TGHS6

Cryo-em structure of respiratory super-complex ci+iii2 from tetrahymena thermophila
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
90
structure length
90
Chain Sequence
LNPYSYEALKENHWLVSDSSKKNSEWTHKSNAEQLIAKVPIIYVDSNIVRCIGGTEINAGHPQVYIQLDTRKHGTPQTCKYCGLRYAKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tetrahymena 's respiratory chain reveal the diversity of eukaryotic core metabolism.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords NADH-ubiquinone oxidoreductase chain 1
total genus 17
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2022-01-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...