7THQC

Crystal structure of pltf trapped with pigg using a proline adenosine vinylsulfonamide inhibitor
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MLESKLINHIATQFLDGEKDGLDSQTPLFELNIVDSAAIFDLVDFLRQESKVSIGMQEIHPANFATVQSMVALVQRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Essential Role of Loop Dynamics in Type II NRPS Biomolecular Recognition.
pubmed doi rcsb
molecule keywords L-proline--[L-prolyl-carrier protein] ligase
molecule tags Ligase/ligase inhibitor
source organism Pseudomonas protegens pf-5
total genus 19
structure length 77
sequence length 77
chains with identical sequence E
ec nomenclature
pdb deposition date 2022-01-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...